PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940544.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 688aa    MW: 76085 Da    PI: 4.3993
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940544.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.58.8e-52231501128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtd+elv++yLk+kv+gk+l++ ++i+e+d+yk+ePwdLp+  ++ +++ ewyfFs+ d+ky++ +r nr+t++gyWk+tgkd++v 
  XP_010940544.1  23 LAPGFRFHPTDDELVSYYLKRKVAGKSLRV-DAIAEIDLYKCEPWDLPSrsRIVSRDLEWYFFSRVDRKYSNRSRMNRSTAQGYWKTTGKDRPVR 116
                     579***************************.99**************94346667888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +++ +g kktLv++ grap+ge+t+Wvmheyrl
  XP_010940544.1 117 H-NNRIIGNKKTLVYHAGRAPRGERTNWVMHEYRL 150
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6117173IPR003441NAC domain
PROSITE profilePS5100557.53223173IPR003441NAC domain
PfamPF023654.1E-2725150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MNAGASSSNP PPPSTPATTA TQLAPGFRFH PTDDELVSYY LKRKVAGKSL RVDAIAEIDL  60
YKCEPWDLPS RSRIVSRDLE WYFFSRVDRK YSNRSRMNRS TAQGYWKTTG KDRPVRHNNR  120
IIGNKKTLVY HAGRAPRGER TNWVMHEYRL GDQELAGTGI LQDAYVVCRI FKKNGPGPQN  180
GAQYGAPFNE EEWEEDDGNM IVPREDGDDD YNDAREQEQE DLHINDFVRN QYMDNQQANA  240
AGFMVGPDGQ VGASHEEDPS VLLEQNQQIL KDPSLNSDIV ECNYEPELQN SPVFINDMGD  300
NTGMADRSHT PPGQNDGYVE LNDLADAVNA EDHPSEDSVV CPLRTCNDWK SVDGGDDGVN  360
LQEILDVEEF FDTVNENTDQ QEPFQMSPTI QDNYNLQSID LTNPGAGHCP PSCQLAEENT  420
MFYDAHGNDL GFSQDNFAEL NQLLYSPVTD PSGFDTVDKL MAYFDATEDN LHGHTAGSLE  480
KLGCMDSCIL DQLNLTPEFD GINAQQNKVI PPASEANVTS HASSSVSLPD ASNQLYGKTA  540
VNILPDVQRN ESNDNTITKR LVNMLGSISA PPAIAAEYPA GSEKRVGRIS ATHSTSSIHV  600
TTGMIQIRGI TVTGSTEHWS LPKNGDMSLL LSYSLAGDEV RKSMRFDSIS KLQGGPVSMV  660
LRGGCYLFFL SALILTISYK LGLCIYSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-51171739168Stress-induced transcription factor NAC1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940544.10.0PREDICTED: uncharacterized protein LOC105059077
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.12e-86NAC domain containing protein 2